PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G131400.1.p
Common NameSb08g018370, SORBIDRAFT_08g018370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 338aa    MW: 36440.2 Da    PI: 6.3721
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G131400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.9e-163986148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT +Ed+ lv++++  G g+W+  ar  g++Rt+k+c++rw++yl
  Sobic.008G131400.1.p 39 RGPWTVDEDLTLVNYIADNGEGRWNNLARAAGLKRTGKSCRLRWLNYL 86
                          89********************************************97 PP

2Myb_DNA-binding55.51.3e-1792135146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+++++E++l++d+++++G++ W++Ia++++ gRt++++k++w++
  Sobic.008G131400.1.p  92 RGNFSADEQLLILDLHTRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 135
                           89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.733486IPR017930Myb domain
SuperFamilySSF466897.49E-2937133IPR009057Homeodomain-like
SMARTSM007171.6E-133888IPR001005SANT/Myb domain
PfamPF002492.7E-143986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-214093IPR009057Homeodomain-like
CDDcd001671.47E-94186No hitNo description
PROSITE profilePS5129423.13887141IPR017930Myb domain
SMARTSM007177.0E-1591139IPR001005SANT/Myb domain
PfamPF002492.7E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-2494140IPR009057Homeodomain-like
CDDcd001671.00E-1094135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MAAAQQSRSR SSAAAAKAAA CSPGAGGPVE VGEKLELRRG PWTVDEDLTL VNYIADNGEG  60
RWNNLARAAG LKRTGKSCRL RWLNYLRPDV KRGNFSADEQ LLILDLHTRW GNRWSKIAQH  120
LPGRTDNEIK NYWRTRVQKH AKQLNCDANS KRFKDAMRYL WMPHLVDIAA AAATDDEHHH  180
HLSLLHHHQQ QQQEVAGGAG NNGDLAAAGY AAAADVQLHA LSSSGLTTTG MTTTTTSSSD  240
SFASGSYEDG GGLRQFANVL AGEMLLDCGG GDWAAGQEAN NQGLWPSFDY DQSVPAQAAA  300
AAGGGGQFQD PELSGWVQGF SESITDNFWA LEEILRI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-243613924126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0697440.0BT069744.1 Zea mays full-length cDNA clone ZM_BFb0226N11 mRNA, complete cds.
GenBankKJ7276380.0KJ727638.1 Zea mays clone pUT5565 MYB transcription factor (MYB100) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443369.10.0hypothetical protein SORBIDRAFT_08g018370
TrEMBLC5YPU90.0C5YPU9_SORBI; Putative uncharacterized protein Sb08g018370
STRINGSb08g018370.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.16e-73myb domain protein 112